Host taxon 10090
Protein NP_001156491.1
UPF0688 protein C1orf174 homolog isoform 2
Mus musculus
Gene A430005L14Rik, UniProt E9PUH0
>NP_001156491.1|Pseudomona aeruginosa PA01|UPF0688 protein C1orf174 homolog isoform 2
MRSRKASSSHKATDRRTSKKFKYDKGHLVKAELQKLDPKSDISSLPKVAPVAPCENKFAEDSAEAAVSVPESREPPQGCSTPASEEPSVKAENGLSTEPSSAAAAQEPDDSSAGQAEPVPRTEEVRASVLQMDSSIFLDDDSNQPMPVSRFFGNVELMQDLPPASSSYPSMSRREFRKMHFRAKDDEDDAEG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.96 | -0.963209619456967 | 0.017 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)