Host taxon 10090
Protein NP_001298067.1
UPF0687 protein C20orf27 homolog isoform 1
Mus musculus
Gene 1700037H04Rik, UniProt F8WIU1
>NP_001298067.1|Pseudomona aeruginosa PA01|UPF0687 protein C20orf27 homolog isoform 1
MAAANRGECCSKPRVRSIRFAAGHDAEGSQSHVHFDEKLHDSVVMVTQESDNSFLVKVGFLKILHRYEITFTLPPVRRLSKDIRETPVHSLHLKLLSVTPTSEGYSIKCEYSAHKEGVLKEEMLLACEGDIGTCVRVTVQARVMDRHHGTPMLLDGVKCVGAELEYDSEQSDWLGFD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.06 | -1.06410166958328 | 0.005 | 32071273 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)