Host taxon 10090
Protein NP_001093255.1
UPF0462 protein C4orf33 homolog isoform a
Mus musculus
Gene D3Ertd751e, UniProt Q8BGN2
>NP_001093255.1|Pseudomona aeruginosa PA01|UPF0462 protein C4orf33 homolog isoform a
MDFKIEYTWDGFPVRHEPVCVRLSPCEQGVKMEVSAPLFNDPPSPLGEPGKPFSELWNYEVVEAFFLNDTTKQYLEVELCPHGQHLVLLLAGRRNVWKKELPLSFKASRGGTNWEGEAYIPWSYFPPNVTKFNSFAIHGSNDRRVYEALYPVPQHELQQGQKPDFHRLEYFKPFSFNTLLGEEWRQPEPDLW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.99 | -2.98903632835839 | 3.4e-10 | 32071273 | |
Retrieved 1 of 2 entries in 0.5 ms
(Link to these results)