Host taxon 10090
Protein NP_001278221.1
uncharacterized protein MISP3
Mus musculus
Gene Misp3, UniProt Q9CVC4
>NP_001278221.1|Pseudomona aeruginosa PA01|uncharacterized protein MISP3
METPIQREIRRSCEREESLRRSRGLSPGRAGEELIELRVRPVLSRPGSGTPLPRALERARAGAKMQRDIEREAHRQAALASPAVPEPSARRRPQPLDELKRFFEAAAEDGAGLQRQPETGGRLHPAVQDGCPVLGQLPPLVAPSLLEQEVRRVRERERELQLQRRSIYGDAEVQEPAPSLTPSRGDGKLSVIWPPRRRASEKERRP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.69 | -1.69397045679971 | 0.0018 | 32071273 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)