Host taxon 10090
Protein NP_083639.1
uncharacterized protein LOC75610
Mus musculus
Gene 2010109A12Rik, UniProt Q9D875
>NP_083639.1|Pseudomona aeruginosa PA01|uncharacterized protein LOC75610
MKRESAFCVHKEKESLKSMAFLHNLSWHNYCDTVESFLPLISSRKTGIKFLSESLKIMLDIERKKIASEICGERNQSVCENNSPPPQISDVLYHVSWRWPLIDFYWSTETITQEVTAHV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.01 | 5.00617157363481 | 0.021 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)