Host taxon 10090
Protein NP_001139367.1
uncharacterized protein LOC75541 isoform 2
Mus musculus
Gene Nat8f4, UniProt E0CYM0
>NP_001139367.1|Pseudomona aeruginosa PA01|uncharacterized protein LOC75541 isoform 2
MAFYHIRQYQEKDHKKVLELFSRGMKEHVPAAFHHMLTLPQTLLLLPGVPVTIVLVSGSWLLATVCSFLFLLCLRLLIWLSWRNYVATSLQADLADITKSYLNAHGSFWVAESGDQGADRGSGDSGERSSLMSPRQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.95 | -1.95404274756041 | 0.016 | 32071273 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)