Host taxon 10090
Protein NP_001170820.1
uncharacterized protein LOC623121 isoform a
Mus musculus
Gene Ifi213, UniProt Q3UPZ5
>NP_001170820.1|Pseudomona aeruginosa PA01|uncharacterized protein LOC623121 isoform a
MTGEMVNYCKQIVLLSGLEYMNDYNFRALKSLLNHDLKLTKNMQDDYDRINIADLMEEKFPEDAGLSKLIEVCEDIPELAARVDILRKEMEKVKNKTKIKSESSPPPLTSSLMEAWEVEPAMVTASSEVHRLRSH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.75 | 1.75077268385188 | 0.045 | 32071273 | |
Retrieved 1 of 2 entries in 0.5 ms
(Link to these results)