Host taxon 10090
Protein NP_001243240.1
uncharacterized protein LOC381994
Mus musculus
Gene E030018B13Rik, UniProt J3QMS9
>NP_001243240.1|Pseudomona aeruginosa PA01|uncharacterized protein LOC381994
MEARDADRGDLKQGSDMTDSVFSTHAGCAGAHEAEGYPAEWSCITSVSGDGSQAQQSTCSTDEVYPFGHTRSQCAQGFSQDEGQTKKEQKGVRKHWPHTSTVHTQPSNHPELP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.45 | 1.44804669864261 | 0.0005 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)