Host taxon 10090
Protein NP_795899.2
uncharacterized protein LOC319486
Mus musculus
Gene A430057M04Rik, UniProt Q8C520
>NP_795899.2|Pseudomona aeruginosa PA01|uncharacterized protein LOC319486
MVQVSSGGGGHVCWSSEDGTGTSKPTGLHLVRALPTEPRPRAPSGDTWPYCKVRLRTSRHPVAACGTASGEILSRLRSQETLLTCPQGPSNCLRHHLPRPPRTTGRKTQAEASIISAWREELRGGFNATALSPPGSIAHSKCPPKTSHSRGGCNLAPE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 4.63 | 4.62842951826798 | 4.7e-9 | 32071273 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)