Host taxon 10090
Protein NP_775557.1
uncharacterized protein LOC211378 isoform 1
Mus musculus
Gene 6720489N17Rik, UniProt Q8BGU1
>NP_775557.1|Pseudomona aeruginosa PA01|uncharacterized protein LOC211378 isoform 1
MNAVTYEDVHVNFTQEEWALLDPSQKKLYKDVMLEIYRNLSALGVKGVRVQRNPLNILNVIKPLLYMITVMPKGMKGFIQKRSPLKLFTVSKTFYLTQVSKSIKEH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.83 | 1.82844822095825 | 0.00012 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)