Host taxon 10090
Protein NP_082843.2
uncharacterized protein C1orf189 homolog
Mus musculus
Gene 1700094D03Rik, UniProt A0A0R4J089
>NP_082843.2|Pseudomona aeruginosa PA01|uncharacterized protein C1orf189 homolog
MSAEKMTKLEENLQRAVALKKTVDRWRNFHIHCMWQTTLDQRRNLFAALRMKDTKEQELALSNKQLLVVRQAALHELFEKEYQQYQQELNQMGKAFYEERL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.44 | -1.44062318842582 | 3.0e-5 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)