Host taxon 10090
Protein NP_663532.2
uncharacterized protein C1orf159 homolog precursor
Mus musculus
Gene 9430015G10Rik, UniProt A2ASP7
>NP_663532.2|Pseudomona aeruginosa PA01|uncharacterized protein C1orf159 homolog precursor
MALQCLLLLTGLLTGGVCKSTESQAQQPECCMDVVDFNATCLGTGLCGPGCYRHWNADGSASCVRCWNGTLPTYNGSECRILTGRGVQLPMNRSTGTPGQPHFGGPHVAASLFLGTLFISTGLILSVAGFFYLKRSSKLPEVFYRRDRAPVLQPGETAAMVPLPQSSVRKPRYIRREQHPDKNRDPSAFSTVEAHISNV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.55 | -1.54888074753059 | 0.0025 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)