Host taxon 10090
Protein NP_001185718.1
uncharacterized protein C15orf65 homolog
Mus musculus
Gene Ccpg1os, UniProt V9GXK1
>NP_001185718.1|Pseudomona aeruginosa PA01|uncharacterized protein C15orf65 homolog
MARETDCDLDKKTSLTSDAEMRPEPPALCVNPGNPVFSCMLDPKTLHTATSLSKAQMIMYKTSASQYGAFSPRPFFFPCKFLPQEQAFTEHLKTTGFYQNNSLNVGPDRTRTIDSPNYQHTL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -4.21 | -4.21088259715658 | 4.5e-7 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)