Host taxon 10090
Protein NP_081366.1
uncharacterized protein C15orf61 homolog precursor
Mus musculus
Gene 2300009A05Rik, UniProt Q9D7P2
>NP_081366.1|Pseudomona aeruginosa PA01|uncharacterized protein C15orf61 homolog precursor
MEALRRAHEATLRLLLCRPWASGAASRPKPRASEVLTQHLLQRRLPHWTSFCVPYSAVHNDQFGLSHFNWPVLGANYHVLRTGCFPFIKYHCSKAPWQDLAPQDRFFTALKVINLGIPTLLYGLGSWLFARVTETVHTSYGPITIYFLNKEDEGAMY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.72 | -1.71719067064055 | 0.023 | 32071273 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)