Host taxon 10090
Protein NP_808400.1
UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter isoform 2
Mus musculus
Gene Slc35d1, UniProt A2AKQ0
>NP_808400.1|Pseudomona aeruginosa PA01|UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter isoform 2
MAEVHRRQHAPVKGEAPAKSSTHRDEEELGMAPAETLTVFLKLLAAGFYGVSSFLIVVVNKSVLTNYRFPSSLCVGLGQMVATVAVLWVGKTLRVVKFPDFDRNVPRKTFPLPLLYFGNQITGLFSTKKLNLPMFTVLRRFSILFTMFAEGALLKKTFSWGIKMTVFAMIIGAFVAASSDLAFDLEGYVFILINDVLTAANGAYVKQKLDSKELGKYGLLYYNALFMILPTLAIAYFTGDAQKNILITYIGMVFGGDYIFTWTNFIGLNISIAGSLVYSYITFTEEQLSKQSEASNKLDTKGKGAV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.63 | 0.633969968051329 | 0.021 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)