Host taxon 10090
Protein NP_001272857.1
UBX domain-containing protein 10
Mus musculus
Gene Ubxn10, UniProt Q8BG34
>NP_001272857.1|Pseudomona aeruginosa PA01|UBX domain-containing protein 10
MAIEAPVNFAPPERSTVVSTAGDSSTWQPSSLRMHVIRPKSAKGRKRPNLHRPQGMGDGSPSALSSSPPPRSSGSPSNQKPGVCATVSTSQGAPDEMPELLLQQAPTRTASSLNRYPVLPSINRRSLEVGAVDTVASKTSSLQLSSVQALYQEDSSQEDSRTQVCALEKKFIIRTKRQSSSRASNIEEPSDEEPRLLLAVRSPSGQRFVRYFRPSDDLQTVLEVAEQKNKATYQHCSIETMEVPRRRFSDLTKSLQECGILHKSVLGISQEEGEAWP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.76 | -2.76325387476556 | 9.6e-17 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)