Host taxon 10090
Protein NP_079677.1
ubiquitin-like protein 5 isoform 2
Mus musculus
Gene Ubl5, UniProt Q9EPV8
>NP_079677.1|Pseudomona aeruginosa PA01|ubiquitin-like protein 5 isoform 2
MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.92 | 0.920889772533828 | 0.01 | 32071273 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)