Host taxon 10090
Protein NP_036038.1
ubiquitin-like protein 3 isoform a precursor
Mus musculus
Gene Ubl3, UniProt Q9Z2M6
>NP_036038.1|Pseudomona aeruginosa PA01|ubiquitin-like protein 3 isoform a precursor
MSSHVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.64 | 0.636698920527502 | 5.4e-18 | 32071273 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)