Host taxon 10090
Protein NP_080711.1
ubiquitin-fold modifier 1 precursor
Mus musculus
Gene Ufm1, UniProt P61961
>NP_080711.1|Pseudomona aeruginosa PA01|ubiquitin-fold modifier 1 precursor
MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.1 | 1.10380965228716 | 7.8e-13 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)