Host taxon 10090
Protein NP_080049.3
ubiquitin-conjugating enzyme E2 W isoform 1
Mus musculus
Gene Ube2w, UniProt Q8VDW4
>NP_080049.3|Pseudomona aeruginosa PA01|ubiquitin-conjugating enzyme E2 W isoform 1
MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPIHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.46 | 0.457842995957568 | 0.001 | 32071273 | |
Retrieved 1 of 3 entries in 1.5 ms
(Link to these results)