Host taxon 10090
Protein NP_001298075.1
ubiquitin-conjugating enzyme E2 variant 1 isoform 3
Mus musculus
Gene Ube2v1, UniProt Q9CZY3
>NP_001298075.1|Pseudomona aeruginosa PA01|ubiquitin-conjugating enzyme E2 variant 1 isoform 3
MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRVDPRATAVLAKWQNSHSIKVILQELRRLMMSKENMKLPQPPEGQCYSN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.76 | 0.75719783223535 | 0.0063 | 32071273 | |
Retrieved 1 of 3 entries in 1.9 ms
(Link to these results)