Host taxon 10090
Protein NP_033485.1
ubiquitin-conjugating enzyme E2 H isoform 1
Mus musculus
Gene Ube2h, UniProt P62257
>NP_033485.1|Pseudomona aeruginosa PA01|ubiquitin-conjugating enzyme E2 H isoform 1
MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.58 | 0.575040197947063 | 2.9e-12 | 32071273 | |
Retrieved 1 of 4 entries in 1 ms
(Link to these results)