Host taxon 10090
Protein NP_080261.2
ubiquitin-conjugating enzyme E2 G1
Mus musculus
Gene Ube2g1, UniProt P62254
>NP_080261.2|Pseudomona aeruginosa PA01|ubiquitin-conjugating enzyme E2 G1
MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.15 | 1.15447114085871 | 9.9e-17 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)