Host taxon 10090
Protein NP_079632.1
ubiquitin-conjugating enzyme E2 D3 isoform 1
Mus musculus
Gene Ube2d3, UniProt P61079
>NP_079632.1|Pseudomona aeruginosa PA01|ubiquitin-conjugating enzyme E2 D3 isoform 1
MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.58 | 1.58031316071064 | 8.0e-115 | 32071273 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)