Host taxon 10090
Protein NP_064296.1
ubiquitin-conjugating enzyme E2 D2
Mus musculus
Gene Ube2d2a, UniProt Q3UT95
>NP_064296.1|Pseudomona aeruginosa PA01|ubiquitin-conjugating enzyme E2 D2
MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.67 | 0.666166465261364 | 1.4e-9 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)