Host taxon 10090
Protein NP_001029037.1
ubiquitin-40S ribosomal protein S27a precursor
Mus musculus
Gene Rps27a, UniProt P62983
>NP_001029037.1|Pseudomona aeruginosa PA01|ubiquitin-40S ribosomal protein S27a precursor
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMGSHFDRHYCGKCCLTYCFNKPEDK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.74 | 0.741777952232478 | 0.00022 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)