Host taxon 10090
Protein NP_663475.1
ubiquitin domain-containing protein 1
Mus musculus
Gene Ubtd1, UniProt Q91WB7
>NP_663475.1|Pseudomona aeruginosa PA01|ubiquitin domain-containing protein 1
MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPEPTPSVRREFPLKVRLSTGKDVRLNASLPDTVGQLKRQLHSQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.65 | 1.64589033710078 | 4.7e-13 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)