Host taxon 10090
Protein NP_001153828.1
ubiquinol-cytochrome-c reductase complex assembly factor 3
Mus musculus
Gene Uqcc3, UniProt Q8K2T4
>NP_001153828.1|Pseudomona aeruginosa PA01|ubiquinol-cytochrome-c reductase complex assembly factor 3
MEVARKALVAVAVLGGGAGVGSILFALVTPGELQKQSMLQEMPERDSRRRDEAVRTTELVMATLKDAAATKENVAWRRNWTVSGDGRSA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.84 | -1.83915934092246 | 0.004 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)