Host taxon 10090
Protein NP_001289283.1
UBAP1-MVB12-associated (UMA)-domain containing protein 1 isoform 2
Mus musculus
Gene Umad1, UniProt E0CXP6
>NP_001289283.1|Pseudomona aeruginosa PA01|UBAP1-MVB12-associated (UMA)-domain containing protein 1 isoform 2
MFHFFRKPAESKKPSGPEPEADGFVLLGATANEVRCKTSEAEGSQALETGKEDTSSVTVSGPETENQTGQTLQNNSLTAELLSDVPFTLAPHVLAAQGTISDLPDHVLSYDVGDNLSRFWYDFTLENSVLCDL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.12 | -2.12121377629841 | 2.9e-5 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)