Host taxon 10090
Protein NP_080308.1
U6 snRNA-associated Sm-like protein LSm1
Mus musculus
Gene Lsm1, UniProt Q8VC85
>NP_080308.1|Pseudomona aeruginosa PA01|U6 snRNA-associated Sm-like protein LSm1
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVQQQTRLEAEKLKVQTLKDRGLSIPRADTLDEY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.96 | 0.960087302002247 | 0.002 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)