Host taxon 10090
Protein NP_067310.1
U2 small nuclear ribonucleoprotein B''
Mus musculus
Gene Snrpb2, UniProt Q9CQI7
>NP_067310.1|Pseudomona aeruginosa PA01|U2 small nuclear ribonucleoprotein B''
MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTMEQAAAAANKKPGQGTPNAANTQGTAAPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1 | 1.00344906904227 | 0.00057 | 32071273 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)