Host taxon 10090
Protein NP_067311.4
U2 small nuclear ribonucleoprotein A'
Mus musculus
Gene Snrpa1, UniProt P57784
>NP_067311.4|Pseudomona aeruginosa PA01|U2 small nuclear ribonucleoprotein A'
MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSAGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPSDEGEEEIEDDTVTNGS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.77 | 0.767215424723118 | 0.036 | 32071273 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)