Bacterial taxon 208964
Protein WP_003101516.1
type VI secretion system effector Tse2
Pseudomona aeruginosa PA01
Gene tse2, UniProt Q9I0E0
>WP_003101516.1|Pseudomona aeruginosa PA01|type VI secretion system effector Tse2
MSYDYEKTSLTLYRAVFKANYDGDVGRYLHPDKELAEAAEVAPLLHPTFDSPNTPGVPARAPDIVAGRDGLYAPDTGGTSVFDRAGVLRRADGDFVIPDGTDIPPDLKVKQDSYNKRLQATHYTIMPAKPMYREVLMGQLDNFVRNAIRRQWEKARGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●○○ -2.1 | -2.09506422440107 | 9.9e-15 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)