Bacterial taxon 208964
Protein WP_003104971.1
type VI secretion system baseplate subunit TssE
Pseudomona aeruginosa PA01
Gene tssE1, UniProt Q9I745
>WP_003104971.1|Pseudomona aeruginosa PA01|type VI secretion system baseplate subunit TssE
MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLNQLKASVLRDLAWLFNTTSLFDHGPAARMPAGNSVLNYGLPALAGHTASSVDVHAIEALLTETIATFEPRIIRSSLRVRAQLLPGEMDHNALSFEIEGDLWAEPAPLRLLLTTNLDLETGHVRVAQGERRRT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●○○○ 1.31 | 1.30800045399384 | 2.1e-9 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)