Host taxon 10090
Protein NP_075540.1
twisted gastrulation protein homolog 1 precursor
Mus musculus
Gene Twsg1, UniProt Q9EP52
>NP_075540.1|Pseudomona aeruginosa PA01|twisted gastrulation protein homolog 1 precursor
MKSHYIVLALASLTFLLCLPVSQSCNKALCASDVSKCLIQELCQCRPGEGNCPCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHHQNVSVPSNNVHAPFPSDKERMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.43 | -0.434251796107588 | 5.1e-8 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)