Bacterial taxon 208964
Protein WP_003095893.1
twin-arginine translocase TatA/TatE family subunit
Pseudomona aeruginosa PA01
Gene tatA, UniProt Q9HUB5
>WP_003095893.1|Pseudomona aeruginosa PA01|twin-arginine translocase TatA/TatE family subunit
MGIFDWKHWIVILIVVVLVFGTKRLKNLGSDVGEAIKGFRKAVNTEEDDKKDQPAAQPAQPLNQPHTIDAQAQKVEEPARKD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●○○○○ -0.83 | -0.831845181350586 | 1.0e-15 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)