Host taxon 10090
Protein NP_062716.1
tumor suppressor candidate 2
Mus musculus
Gene Tusc2, UniProt Q9WVF8
>NP_062716.1|Pseudomona aeruginosa PA01|tumor suppressor candidate 2
MGASGSKARGLWPFASTPGGGGPEAAGSEQSLVRSRARAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDPPRIHVDFPVILYEV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.45 | -1.44763285899756 | 7.7e-8 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)