Host taxon 10090
Protein NP_001186034.1
tumor protein p53-inducible nuclear protein 1 isoform 2
Mus musculus
Gene Trp53inp1, UniProt Q9QXE4
>NP_001186034.1|Pseudomona aeruginosa PA01|tumor protein p53-inducible nuclear protein 1 isoform 2
MFQRLNKMFVGEVTTSSSQEPEFSEKEDDEWILVDFIDTCPGFSAEEEEEDEDIGEESSAEHTSVFSCLPASLECLTDTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEASCGNDEYNSSGPRARKSCL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.96 | 0.959135503466271 | 2.1e-29 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)