Host taxon 10090
Protein NP_001020433.1
tumor protein D52 isoform 2
Mus musculus
Gene Tpd52, UniProt Q62393
>NP_001020433.1|Pseudomona aeruginosa PA01|tumor protein D52 isoform 2
MECRDMELADDYQSPFDFDSGVNKNYLYLSPSGNTSPPGSPTQNVGLLKTEPVAEEGEDAVTMLSAPEALTEEEQEELRRELTKVEEEIQTLSQVLAAKEKHLAELKRKLGISSLQEFKQNIAKGWQDVTATNAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGAKPAGGDFGEVLNSTANATSTMTTEPPPEQMTESP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.03 | 2.02884764517852 | 6.4e-96 | 32071273 | |
Retrieved 1 of 3 entries in 0.5 ms
(Link to these results)