Host taxon 10090
Protein NP_001028333.1
tumor necrosis factor receptor type 1-associated DEATH domain protein
Mus musculus
Gene Tradd, UniProt Q3U0V2
>NP_001028333.1|Pseudomona aeruginosa PA01|tumor necrosis factor receptor type 1-associated DEATH domain protein
MAAGQNGHEEWVGSAYLFLESAVDKVILSEAYTDPKKKVAIYKALQTALSESGDSSDVLQILKIHCSDPQLIVQLRFCGRVLCGRFLQAYREGALRTALQRCMAPALAQEALRLQLELRAGAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDCTGQGGAIQVASAGSKFPVSSPTEEKPLPAACQTFLFHGQLVVNRPLTLQDQQTFARSVGLKWRRVGRSLQRNCRALRDPALDSLAYEYERDGLYEQAFQLLRRFMQAEGRRATLQRLVEALEENELTSLAEDLLGQAEPDGGLA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.14 | -1.14263450109782 | 0.0028 | 32071273 | |
Retrieved 1 of 2 entries in 2.1 ms
(Link to these results)