Host taxon 10090
Protein NP_001070977.1
tumor necrosis factor receptor superfamily member 9 isoform 1 precursor
Mus musculus
Gene Tnfrsf9, UniProt P20334
>NP_001070977.1|Pseudomona aeruginosa PA01|tumor necrosis factor receptor superfamily member 9 isoform 1 precursor
MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLTLFLALTSALLLALIFITLLFSVLKWIRKKFPHIFKQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.98 | 5.98115720451135 | 1.1e-45 | 32071273 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)