Host taxon 10090
Protein NP_035741.2
tumor necrosis factor receptor superfamily member 5 isoform 1 precursor
Mus musculus
Gene Cd40, UniProt P27512
>NP_035741.2|Pseudomona aeruginosa PA01|tumor necrosis factor receptor superfamily member 5 isoform 1 precursor
MVSLPRLCALWGCLLTAVHLGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRALLVIPVVMGILITIFGVFLYIKKVVKKPKDNEILPPAARRQDPQEMEDYPGHNTAAPVQETLHGCQPVTQEDGKESRISVQERQVTDSIALRPLV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.8 | 1.80284467504398 | 2.0e-19 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)