Host taxon 10090
Protein NP_783580.1
tumor necrosis factor receptor superfamily member 26 precursor
Mus musculus
Gene Tnfrsf26, UniProt P83626
>NP_783580.1|Pseudomona aeruginosa PA01|tumor necrosis factor receptor superfamily member 26 precursor
MTRLRLLLLLGLLLRVAVCSVNTITLCKIGEFKHENLCCLQCSAGTYLRNPCQENHNKSECAPCDSEHFIDHKNRESECFPCSVCRDDQEEVAKCSRTADRVCQCKQGTYCDSENCLERCHTCSSCPDGRVVRKCNATMDTVCDKFDSEPGQSGSQCFCFSKPLGIVVIIAAFIIIIGAVIILILKIICYCKRGENIQLSSTML
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.94 | 1.94330383613256 | 1.2e-11 | 32071273 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)