Host taxon 10090
Protein NP_077252.2
tumor necrosis factor receptor superfamily member 23 isoform 1 precursor
Mus musculus
Gene Tnfrsf23, UniProt Q9ER63
>NP_077252.2|Pseudomona aeruginosa PA01|tumor necrosis factor receptor superfamily member 23 isoform 1 precursor
MVTFSHVSSLSHWFLLLLLLNLFLPVIFAMPESYSFNCPDGEYQSNDVCCKTCPSGTFVKAPCKIPHTQGQCEKCHPGTFTGKDNGLHDCELCSTCDKDQNMVADCSATSDRKCECQIGLYYYDPKFPESCRPCTKCPQGIPVLQECNSTANTVCSSSVSNPRNWLFLLMLIVFCI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.72 | 1.72475869904721 | 0.0011 | 32071273 | |
Retrieved 1 of 3 entries in 0.4 ms
(Link to these results)