Host taxon 10090
Protein NP_062291.1
tumor necrosis factor ligand superfamily member 14
Mus musculus
Gene Tnfsf14, UniProt Q9QYH9
>NP_062291.1|Pseudomona aeruginosa PA01|tumor necrosis factor ligand superfamily member 14
MESVVQPSVFVVDGQTDIPFRRLEQNHRRRRCGTVQVSLALVLLLGAGLATQGWFLLRLHQRLGDIVAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.62 | 2.61945190181753 | 4.6e-6 | 32071273 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)