Host taxon 10090
Protein NP_001171231.1
tumor necrosis factor alpha-induced protein 8 isoform 3
Mus musculus
Gene Tnfaip8, UniProt Q921Z5
>NP_001171231.1|Pseudomona aeruginosa PA01|tumor necrosis factor alpha-induced protein 8 isoform 3
MATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTKEYTQNKKEAERVIKNLIKTVIKLAVLHRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQIVIDLQELNLRQSNRMLRKAKKTVHLKS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.47 | 1.47308605711266 | 1.5e-16 | 32071273 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)