Host taxon 10090
Protein NP_033347.1
tubulin-specific chaperone A
Mus musculus
Gene Tbca, UniProt P48428
>NP_033347.1|Pseudomona aeruginosa PA01|tubulin-specific chaperone A
MADPRVRQIKIKTGVVRRLVKERVMYEKEAKQQEEKIEKMKAEDGENYAIKKQAEILQESRMMIPDCQRRLEAAYTDLQQILESEKDLEEAEEYKEARVVLDSVKLEA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.74 | -0.736807853429364 | 0.016 | 32071273 | |
Retrieved 1 of 2 entries in 2.1 ms
(Link to these results)