Host taxon 10090
Protein NP_080757.1
tubulin polymerization-promoting protein family member 3
Mus musculus
Gene Tppp3, UniProt Q9CRB6
>NP_080757.1|Pseudomona aeruginosa PA01|tubulin polymerization-promoting protein family member 3
MAASTDIAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKAVTGTDVDIVFSKVKAKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLIAGKEPANIGVTKAKTGGAVDRLTDTSKYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.41 | -1.40783530320512 | 7.4e-36 | 32071273 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)