Host taxon 10090
Protein NP_033392.1
TSC22 domain family protein 1 isoform 2
Mus musculus
Gene Tsc22d1, UniProt P62500
>NP_033392.1|Pseudomona aeruginosa PA01|TSC22 domain family protein 1 isoform 2
MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGSTA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.35 | -0.349283285720319 | 2.4e-6 | 32071273 | |
Retrieved 1 of 6 entries in 1 ms
(Link to these results)