Host taxon 10090
Protein NP_081738.2
tryptophan--tRNA ligase, mitochondrial precursor
Mus musculus
Gene Wars2, UniProt Q9CYK1
>NP_081738.2|Pseudomona aeruginosa PA01|tryptophan--tRNA ligase, mitochondrial precursor
MALFSVRKARECWRFIRALHKGPAATLAPQKESGERVFSGIQPTGILHLGNYLGAIESWVNLQEEYDTVIYSIVDLHSITVPQDPTVLQQSILDMTAVLLACGINPEKSILFQQSKVSEHTQLSWILTCMVRLPRLQHLHQWKAKAAKQKHDGTVGLLTYPVLQAADILCYKSTHVPVGEDQVQHMELVQDLARSFNQKYGEFFPLPKSILTSMKKVKSLRDPSSKMSKSDPDKLATVRITDSPEEIVQKFRKAVTDFTSEVTYEPDSRAGVSNMVAIHAAVSGLSVEEVVRSSAGLDTARYKLLVADAVIEKFAPIRKEIEKLKMDKDHLRKVLLVGSAKAKELASPVFEEVKKLVGIL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.14 | -1.13539958852167 | 0.00079 | 32071273 | |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)